AI GOVERNANCE
- Build in the Open: Funding the Future of Trustworthy Tech : Grounded by our own open source roots, Mozilla has long funded open source technologies that help to untangle thorny sociotechnical issues. From the M...
- Addressing AI Bias in Maternal Healthcare in Southern Africa : An ethnographic research into the datasets powering maternal healthcare app “DawaMom” used across Zambia and other Southern African countries (LUSAKA,...
- MozFest House Zambia 2024 Recap: A Celebration of Solidarity : MozFest House Zambia took place on November 20-21, 2024 at the Lusaka International Conference Center. Over 500 technologists, activists, funders, and...
- Common Voice 20 is Now Available : The Common Voice team is honoured to be able to announce that the 20th version of our multilingual, open speech dataset is now available. This dataset...
- Build in the Open: Scouting Tech's Boldest Changemakers : For over a decade, Mozilla Fellowships have sought to nurture talent at the intersection of technology and society. Launched in 2011, our fellowships ...
- AI in Africa: Promise, Pitfalls, and Politics : At MozFest House Zambia, Skoll Foundation brought together technologists, policymakers, and activists who are implementing AI solutions on the contine...
- Mozilla Expands Volunteer-led Push for Inclusive AI in Taiwanese Indigenous Languages : Mozilla’s Common Voice now features 60 hours of speech datasets in eight new Indigenous languages. Meet the Taiwan Language volunteers at RightsCon on...
AI NEWS
- ‘The frontline is everywhere’: new MI6 head to warn of growing Russian threat
- Grok got crucial facts wrong about Bondi Beach shooting
- Build vs buy is dead — AI just killed it
- AI agents debate their way to improved mathematical reasoning
- An AI-Powered Toy Is Regaling Children With Chinese Communist Party Talking Points
- Trump Orders States Not to Protect Children From Predatory AI
- Reasoning models now ace all three CFA exam levels
- CHT blasts Trump's executive order for creating an AI accountability vacuum
- Deepmind co-founder Shane Legg sees 50 percent chance of "minimal AGI" by 2028
- LongCat-Image proves 6B parameters can beat bigger models with better data hygiene
- Adobe brings Photoshop, Acrobat, and Express directly to ChatGPT
- OpenAI drops equity waiting period to encourage risk-taking
- YouTube channels spreading fake, anti-Labour videos viewed 1.2bn times in 2025
- Nate Jones Gets AI Data Centers Wrong
- Google's new live translation beta uses Gemini to preserve tone and rhythm
- More AI agents isn't always better, new Google and MIT study finds
- In Just 28 Days, OpenAI Built Sora’s Android App Using Codex
- Why Indian AI Startups Still Seek Validation from the West
- People Are Already Creating Ghoulishly Horrifying Sora Disney Videos
- Why most enterprise AI coding pilots underperform (Hint: It's not the model)
AI RESEARCH
- Architecting State-of-the-Art Text-to-SQL Agents for Enterprise Complexity
- Time Series Forecasting in Practice: Data, Databases, and Models
- Your Laptop Is Now an AI Co-Worker: How Local LLMs Supercharge Real Work
- From Gauss to Transformers: A Surprising Link Between Weighted Least Squares and Self-Attention
- Progressive Loading: A Classic Pattern to Scale Modern AI
- Building a Streaming AI Agent with LangChain, MistralAI and Next.js
- Reinforcement Learning (RL) and its role for Large Language Models (LLMs)
- AI and the Future of the Workforce
- Elephant(s) in the room: Graph neural networks, embeddings, and foundation models in spatial data science
- A Comprehensive Guide on Fine-Tuning AI Models On Your Dataset For Beginners
- Introduction to Qwen3-VL
- All About Human in The Loop!
- Building an Agentic Resume Matcher: Python Foundations for GenAI
- A Hidden Line of Text Can Hijack an AI — No Clicks, No Malware, Just Words
- SAP Datasphere MCP server. Release blog
- 2025 Open Models Year in Review
- How Companies Can Start Building With AI (Without Breaking Everything)
- I Read OpenAI’s GPT‑5.2 Prompting Guide So You Don’t Have To
- The Linux Moment for AI Has Arrived: MCP, Agents, and the Linux AI Foundation
- They Taught AI to Speak Chinese Like a Human Using Video Game Logic
- Router-Based Agents: The Architecture Pattern That Makes AI Systems Scale
- AI finds a hidden stress signal inside routine CT scans
- AI Didn’t Break Your Security. It Just Moved Fast Enough to Show How Broken It Already Was
- Turn Your MySQL into an AI Knowledge Base Today
- The Sequence Radar #771: Last Week in AI: GPT-5.2, Mistral, and Google’s Agent Stack
- The Architecture of a Small LLM (Explained Like You’re 18)
- RAG Pipeline : A Complete Guide
- Serving Machine Learning Models as FastAPI Endpoints
- What Jailbreaking Actually Teaches Us About AI Consciousness
- Part 4: Building a Real DevOps Agent — A Step-by-Step Tutorial
- Building Real AI Cloud Systems — Series 2, Part 1: Building a Real AI Cloud Agent — A…
- Building AI-Driven Forecasting Systems for Resilient Supply Chains
- I Watched AI Fail at Math Three Times. The Third Time Taught Me Something Nobody Teaches
- Data Scientists Don’t Need More Models — They Need Better Thinking
- Why Large Language Models Prove Language Is Not Intelligence
- Agentic AI in Fintech: How Autonomous Agents End “Click and Pray” Banking
- Beyond the Screen: Inside Avinash Balachandran’s Vision for Human-Centered Embodied Intelligence
AI TOOLS
CLOUD BUSINESS
- So many button batteries I've tested have hidden dangers - but this brand gets it right
- 20+ useful Roku shortcuts and menus that every user should know about (and how to access them)
- The Real Bottleneck in Enterprise AI Isn’t the Model, It’s Context
- Fedora Silverblue Has a Handy Tool To Help Simplify Development
- Adafruit: Arduino’s Rules Are ‘Incompatible With Open Source’
- Stop using your router's USB port - what PC experts recommend instead
- The 5 most innovative tech products that surprised us this year (including a first for robot vacs)
- Three Core Principles for Sustainable Platform Design
CLOUD SECURITY
- How do I implement Agentic AI in financial services
- How can Agentic AI enhance our cybersecurity measures
- 2025: The Year Cybersecurity Crossed the AI Rubicon
- Can Agentic AI provide solutions that make stakeholders feel assured?
- 2026 Will Be the Year of AI-based Cyberattacks – How Can Organizations Prepare?
- Why are companies free to choose their own AI-driven security solutions?
CLOUD TECHNICAL
- 🚀 FlowPilot: One assistant on the outside. A full AI team on the inside.
- The Cultural Architecture of AI Agents: An Anthropologist's Journey Through Google's Intensive Participating in Google's 5-Day AI Agents Intensive has been transformative, because it revealed how deeply agentic systems are reshaping cultural transmission.
- JuiceFS+MinIO: Ariste AI Achieved 3x Faster I/O and Cut Storage Costs by 40%+
- My Road to AI Agents: A Google & Kaggle Intensive Course Writing Challenge
- Prompts and coding are the doorway into AI. But they are not the destination. If you stay at the prompt level, you remain an experimenter. If you move to products, you become a builder.
- How To Create An EC2 Instance in AWS.
- From Anthropologist to AI Agent Builder: My 5-Day Journey
- Injecting AI Agents into CI/CD: Using GitHub Copilot CLI in GitHub Actions for Smart Failures
- Make Microsoft Agent Framework’s Structured Output Work With Qwen and DeepSeek Models
- Our RAG system still failed on hierarchical metrics — Part 2
- Your System Prompt is Your Ground Truth: Ditch Manual Labeling for AI Agent Evaluation
- The Psychology Behind WBS: Why Our Brains Fail at Large Task Estimation
- Amazon EC2 Instance Installation.
- Set up a Docker-based development environment using Hiawatha web server, PHP-FPM, and MySQL
- From Prompts to Action: My Journey Through the Google & Kaggle AI Agents Bootcamp
- Maximize Profits: Monetizing AI Conversations Like Google Ads
- Cloud Adoption in Australian Web Development
- 7 Azure Security Gaps I have Seen in Production (and How to Fix Them)
- Decisões demais, estratégia de menos
- Beyond Coding: Your Accountability Buddy with Claude Code Skill
- Another E2E Solution delivered. This time with CI/CD, AWS EventBridge and ECS Fargate
- Full-Stack Development: The AI Evolution
- Why Mathematics Is Essential in Machine Learning
- Creating an EC2 Instance
- 2025-12-14 Daily Robotics News
- 48 Hours to Learn AI Agents: How It Changed My View
- AWS Modulo 3: Lambda con Go
- Managing Local and Remote Podman instances over LazyDocker
- Understanding Agentic AI: How Modern Systems Make Autonomous Decisions
- Why Your AI-Generated Code is Probably Garbage (And How to Fix It)
- Spotify Connect, Raspberry Pi, AirPlay & HomePod - because simple audio setups are boring
- I Built an ML Platform to Monitor Africa's $700B Debt Crisis - Here's What I Learned
- Rethinking Software Engineering: Why It Has Failed at Maintainability
- # From Sailing to Smart Cities: My Year of Building Agents
- Title: I built a 13-app "Zoo" using Gemini Pro 3. The constraint: I wasn't allowed to inspect the code.
- Reinforcement Learning Environments: How AI Agents Learn Through Experience
- When AI Writes Your Code, DevOps Becomes the Last Line of Defense
- The Common Roadblocks for AI Storytelling
- Why Am I Not Making Progress Despite Solving LeetCode Daily? The Plateau Problem
- Bayesian Neural Networks Under Covariate Shift: When Theory Fails Practice
- What the AWS us-east-1 Outage Taught Me About Building Resilient Systems
- Best AI Meeting Note Taker for Smarter, Faster Meeting Documentation
- AWS Security Starter Pack: 5 Essential Tools
- What Is Agentforce Vibes? An Introduction to Salesforce Vibe Coding
- I built a SaaS for $0 in one weekend (LAMP Stack + Free Hosting). Here is what happened.
- My Learning Journey – Google 5-Day AI Agents Intensive & Travel Multi-Agent System
- Monetize Voice AI Solutions for eCommerce Using VAPI Effectively
- Why VM-based obfuscation raises the cost of reversing JavaScript
- Stop Chasing Model Releases: The AI-Native Engineering Playbook for 2026
- 👋 Starting My DevOps Journey!
- The hype cycle is exhausting. Every week brings a new model, a new benchmark, a new "everything has changed" moment. But here's what actually matters: AI is becoming a runtime for software. The winners won't be those who use the latest model,
- Reasons to optimize cloud costs (not just to save money)
- Building Yupcha: An AI Interview Platform for Scalable Hiring
- Brief summary of Agent intensive 5 days course
- Best Cursor Editor Themes 2024: Boost Focus & Reduce Eye Strain | Review
- We Evaluated 13 LLM Gateways for Production. Here's What We Found
- Meet TOON: A Token-First Data Format Built for AI
- Inside Google Jobs Series (Part 11): Cross-Domain & Payment Roles
- Python Guide: How to Detect If a Domain Is a Scam
- From DNS to Containers: How AWS Routes Traffic Using Route 53 and Application Load Balancer
- How to Build a Scalable RAG-Based Chatbot on AWS?
- Join the Microsoft 365 Developer Program
- Understanding AI, ML, DL, NLP, and Data Visualization: A Clear Guide for Beginners
- Why Python Isn’t Enough: What Enterprises Miss When They Think of AI Only as a Data Science Problem
- Blazor SaaS Starter Kits Compared: When to Choose Brick Starter for Full‑Stack C#
- PromptShield AI – An AI Cost & Risk Firewall Built with Xano
- The Complete Guide to Meta-Prompting: The Technique of Having AI Write Your Prompts
- From Confusion to Clarity: Building My First Research Agent in Google's AI Intensive
- Intelligent Multi-Agent Trip Planning System
- New AWS Lambda Durable Functions – Do they replace Step Functions?
- Orchestrating Creativity with Agentic AI: How I Built a Real Business Using Autonomous Agents
- A Good Engineer Never Blames the Domain
- From Beginner to Builder : How The AI Agent Intensive Course Changed My Understanding Of AI
- Building Better AI Prompts from Images: A Step-by-Step with Image2Prompts
- Python - Based Data Science Toolchain for Financial Market Trend Prediction
- The Broke Student’s Guide to the Cloud: How I Host Projects for $0
- Cloud Computing Unveiled: A Beginner's Guide
- How I Built a Daily Self-Love Journaling Habit That Actually Stuck (30-Day Framework)
- Making a WhatsApp Bot that Doesn't Suck (Node.js + GPT-5.2)
- MLOps: Data Science Lifecycle with DataSets examples, Workflows and Pipelines.
- Lessons Learned: Choosing a Flink Distribution for Kubernetes (Bitnami vs Official)
- Why Focusing on People Still Matters in the Age of Artificial Intelligence
- Multi‑Tenant SaaS on .NET: Why a Starter Kit Beats Building from Scratch
- Java Arrays clone() Explained: Deep Dive with Examples & Best Practices
- The End of Prompt Engineering: Entering the Era of Agent Control
- How Microsoft Agent Framework Can Boost Employee Training in 2026 and Beyond
- Kubernetes Just Retired the Ingress Everyone Thought Was “The Default”
- My Fingers Don’t Wait for My Brain — do yours?
- Photovoltaic Geometry: Engineering Analysis of the Anker SOLIX PS200
- How We Cut SaaS Churn by 35% with a Simple, Event-Driven Engine
- Expose Local n8n with a Custom HTTPS Domain Using Cloudflare Tunnel
- Cashflow Insights — AI-Enhanced Backend with Xano
- The Evolution of AI Surveillance
- I Built an AI Movie Recommendation App to End Endless Scrolling
- From Beginner to Builder: How the AI Agents Intensive Course Changed My Understanding of AI
- HTML Tags That'll Make Your Life Easier (No, Really)
- AI Email Personalization: Why Your Predictive Content Blocks Are Probably Creeping People Out
- How I Made Sharp 950x Faster (And Why It Matters After Bun Joined Anthropic)
- Most startups don't fail because of code - they fail because of decisions
- "Teaching AI to Teach: My 5-Day Journey Building an AI Literacy Agent"
- DEV Track Spotlight: Unleash Rust's Potential on AWS (DEV307)
- Building a Simple RAG System Using FAISS
- [AWS] 4. EC2 Instance Storage Section, EBS (Elastic Block Store), AMI (Amazon Machine Image), EFS (Elastic File System)
- AI agents are everywhere, but what actually is an AI Agent?
- Runtime environment variables in Next.js - build reusable Docker images
- Creating an AI Discord Bot with Ollama
- Breaking Down the Cloud: A Simple Guide for Beginners
- How to build an intelligent agent that can automatically score submitted Python files and reports?
- STOPSIGNAL is now available on Amazon ECS Fargate
- Production-Ready E-commerce Price Tracker API: A Xano AI Challenge Submission
- AI 브라우저를 활용한 PR 메세지 자동화
- I Thought AI Agents Were Just Prompts. This Course Proved Me Wrong.
- Hi tech gurus - I’m building devars, a developer-focused platform for AI-assisted tooling.
- An Intro to Large Language Models and the Transformer Architecture: Talking to a calculator
DEVOPS
FINANCIAL
- CNBC Daily Open: Investors sell off tech despite steady Broadcom numbers
- Trump Called 'Insensitive' After Posting 'Cheery' Christmas Portrait Amid 'Tragic' Brown University Shooting
- Broadcom and Costco's rich valuations leave little room for error as battleground stocks
- The hot trade: hedging against the AI bubble popping
- AI fever echoes dot-com era, but some key twists: WSJ analysis
- ServiceNow is said to prepare $7B deal for cybersecurity firm Armis
- ServiceNow in talks to acquire cybersecurity startup Armis in potential $7 billion deal, Bloomberg reports
- Chip makers upbeat on supply/demand dynamics heading into 2026: BNP Paribas
- Trump Claims 'High Household Bills' Problem Is a Hoax Amid Melania's $5k Velvet Blazer
- ICE Detains Naturalised American Citizen in Minneapolis After Being Targeted for His 'Somali' Features
- Is Trump Sundowning? Official Raises Eyebrows With Revelation of President's 4-Hour Sleep Routine
- 'I Need You Right Now, Pedophiles': Trump Campaign Email Sent to Epstein After His Death, Records Claim
- Violent Clashes Between Haitian Gangs Kills Dozens, Including a Top Viv Ansanm Leader
- Oracle racks up bullish views despite worst weekly drop in seven years
- Intel said to be nearing $1.6B deal to buy AI chip startup SambaNova
- US, UK tech trade deal at risk over disagreements - report
- Insider trades: Nvidia, Salesforce, AMD among notable names this week
- Here are 4 major moments that drove the stock market last week
- AI order from Trump might be ‘illegal,’ Democrats and consumer advocacy groups claim
GENERAL US
- What Is Artificial Intelligence (AI)? Overview, Types, and Importance - The Motley Fool
- New Illinois laws aimed at workers limit the use of AI in hiring processes - NBC 5 Chicago
- The agentic reality check: Preparing for a silicon-based workforce - Deloitte
- Executive Order to challenge or deter state laws that would impact artificial intelligence (AI) - Economic Policy Institute
- AI executive order could deepen trust crisis, not solve it - Federal News Network
- WP Intelligence Briefing: How to manage third-party AI risk - The Washington Post
- Trump signs executive order to block state AI regulations - The Washington Post
- Disney invests $1B in OpenAI in deal to bring characters like Mickey Mouse to Sora AI video tool - The Washington Post
- The AI data center boom is coming for Kentucky. What will lawmakers do about it? - Louisville Public Media
- Why news organizations are suing AI companies, and what they hope to win - NPR
- Open AI, Microsoft face lawsuit over ChatGPT's alleged role in Connecticut murder-suicide - The Washington Post
- Jamie Dimon says soft skills like emotional intelligence and communication are vital as AI eliminates roles - Fortune
- Pennsylvania judge questions potential AI hallucinations in legal brief for gender-identity suit - 90.5 WESA
- President Trump Signs EO to Stop State and Local Regulation of AI - Ogletree
- Instacart and OpenAI partner on AI shopping experiences - OpenAI
- The View From Inside the AI Bubble - The Atlantic
- Fresh Concerns About AI Spending Are Rattling Wall Street - The Wall Street Journal
- Leonardo DiCaprio Says AI Can’t Be Art Because “There’s No Humanity to It” - The Hollywood Reporter
- We’re running out of good ideas. AI might be how we find new ones. - Vox
- AI masking the economy cuts both ways - Reuters
- How the U.S. Can Win the AI Race - Time Magazine
- MAGA scrambles to influence Trump's AI executive order - Axios
- Meet My Top 5 Artificial Intelligence (AI) Stocks for 2026 - The Motley Fool
- Amputees often feel disconnected from their bionic hands. AI could bridge the gap : Shots - Health News - NPR
- The future of the internet in the age of AI - Brookings
- Are Generative AI Wildlife Videos Art or Slop? We Went Looking for Answers. - Outside Magazine
- Purdue unveils comprehensive AI strategy; trustees approve ‘AI working competency’ graduation requirement - Purdue University
- Newsletter | Rubio vs. Nvidia, AI cyberdefenses, Chinese pharma risk - The Washington Post
- Questions of accuracy arise as Washington Post uses AI to create personalized podcasts - NPR
- Researchers unveil groundbreaking 3D chip to accelerate AI - Stanford Report
- Caitlin Clark and the ‘young and turnt’ bring a new vibe to Team USA - The Washington Post
- Nicolais: Artificial intelligence makes it tougher to spot fake news every day - The Colorado Sun
- AI Surveillance Startup Caught Using Sweatshop Workers to Monitor US Residents - Futurism
- Microsoft invests US$17.5 billion in India to drive AI diffusion at population scale - Microsoft Source
- Arizona city unanimously rejects AI data center after residents' outcry - Fox Business
- Broadcom tumbles 11% despite blockbuster earnings as 'AI angst' weighs on Oracle, Nvidia - CNBC
- AI tools could drive $263 billion in holiday sales. Walmart and Target are racing to get in - CNBC
- Could America win the AI race but lose the war? - Financial Times
- Exclusive / Washington Post’s AI-generated podcasts rife with errors, fictional quotes - https-//www.semafor.com
- AI race comes down to power and data centres - and China has the edge, says unicorn hunter - Yahoo Finance
- How to use Gemini Live API Native Audio in Vertex AI - Google Cloud
- Riyadh Air and IBM Partner to Launch World's First AI-Native Airline - IBM Newsroom
- AI Applications Engineer - classifiedsmarketplace.washingtonpost.com
- Hochul signs several bills into law on artificial intelligence regulations - NY State of Politics
- Critical AI Health Literacy as Liberation Technology: A New Skill for Patient Empowerment - National Academy of Medicine
- "I was forced to use AI until the day I was laid off." Copywriters reveal how AI has decimated their industry - bloodinthemachine.com
- AI Comes of Age - Columbia University Mailman School of Public Health
- How Trump’s tech advisers overcame a MAGA rebellion over AI - The Washington Post
- The AI energy challenge: How to scale responsibly and win - The World Economic Forum
- ‘Greetings, earthlings’: Nvidia-backed Starcloud trains first AI model in space as orbital data center race heats up - CNBC
- SONIA PILCER: The literary taboo of AI - The Berkshire Edge
- Artificial Intelligence - The Washington Post
- HHS Releases Strategy Positioning Artificial Intelligence the Core of Health Innovation | Insights - Holland & Knight
- Microsoft’s Mustafa Suleyman: ‘AI Is Already Superhuman’ - Bloomberg.com
- Trump's order targeting state AI laws faces political and legal hurdles - Reuters
- Don’t Panic Yet Over AI Chip Sales to China - Carnegie Endowment for International Peace
- Gavin Newsom pushes back on Trump AI executive order preempting state laws - The Guardian
- Meet My Top 5 Artificial Intelligence (AI) Stocks for 2026 - Yahoo Finance
- Purdue University Approves New AI Requirement For All Undergrads - Forbes
- The AI skills gap is really a ‘critical thinking’ gap: The Fortune 500 fears it can’t find talent with enough sharp thinking - Fortune
- This Week in DOW: Unleashing AI, Growing Australian Partnership, Breaking Ground for Future Spacecom Home - U.S. Department of War (.gov)
- Trump tech adviser David Sacks under fire over vast AI investments - NPR
- Trump’s executive order limits state regulations of artificial intelligence - PBS
- 'Godfather of AI' says CS degrees 'will remain valuable for quite a long time' — and students should still learn to code - Business Insider
- Data centers for AI could nearly triple San Jose’s energy use. Who foots the bill? - CalMatters
- More AI tools coming in days or weeks, Pentagon R&D chief says - Defense One
MAINSTREAM
- 'IT: Welcome to Derry' Ending Explained: What's Next for the Stephen King Series
- It’s 43 hours from L.A. to Chicago. These train people like it that way - Los Angeles Times
- ServiceNow Said to Near Deal to Buy Armis for Up to $7 Billion - Bloomberg.com
- Jimmy Lai is a Hong Kong rags-to-riches media tycoon who became a fierce critic of Beijing - AP News
- Bondi beach was a laid-back haven before a mass shooting horror unfolded - AP News
- China’s Retail Sales Weaken to Worst Since Covid as Growth Slows - Bloomberg.com
- Hong Kong tycoon Jimmy Lai found guilty of collusion with foreign forces - Reuters
- Australia's Fortescue to buy remaining stake in Alta Copper, valuing it at $101 million - Reuters
- Meet Ukraine’s small but lethal weapon lifting morale: Unmanned sea drones packed with explosives - AP News
- Gold Holds Gains as Divergent Fed Remarks Temper Easing Outlook - Bloomberg.com
- Jimmy Lai live: Hong Kong court to rule after democracy activist's landmark trial - Reuters
- Hailee Steinfeld and NFL husband Josh Allen are expecting their first child - AP News
- Person of interest detained in fatal mass shooting at Brown University. - Reuters
- Brazilians rally against effort to soften punishment for Bolsonaro, allies - Reuters
- Google pulls AI-generated videos of Disney characters from YouTube in response to cease and desist
- Canada’s Air Force Buys Six Bombardier Jets for $547 Million - Bloomberg.com
- Hassett says Federal Reserve can reject Trump’s views if he is chair - AP News
- Stocks of private companies like OpenAI and SpaceX are being sold via invitation-only markets to the ultrawealthy before their IPOs, creating a two-tier system (Corrie Driebusch/Wall Street Journal)
- No. 1 Indiana keeps defensive coordinator Bryant Haines with new contract, AP source says - AP News
- Ukraine, US peace talks in Berlin end, to resume Monday, Zelenskiy adviser says - reuters.com
- Grok is spreading inaccurate info again, this time about the Bondi Beach shooting
- ‘Bel-Air’ had its series finale. And its TV mom says the goodbye was ‘full of gratitude’ - Los Angeles Times
- JetBlue flight near Venezuela avoids ‘midair collision’ with US Air Force tanker - AP News
- Delivery Hero Chair Kristin Skogen Lund backs CEO Niklas Östberg as the group explores asset sales amid shareholder pressure over its falling stock price (Kieran Smith/Financial Times)
- Kindle's in-book AI assistant can answer all your questions without spoilers
- Netanyahu Says Australia Failed to Protect Jews Despite Warning - Bloomberg.com
- No charges for ‘Capt. Hollywood’; detectives claim LAPD mishandled CBS exec case leak - Los Angeles Times
- Person of interest detained in Brown University shooting that killed 2 and wounded 9 - AP News
- Investors seek protection from risk of AI debt bust
- Britain's King Charles 'appalled and saddened' by shooting in Sydney - Reuters
- Nvidia's new monitoring software shows where AI GPUs are running worldwide
- Solve Intelligence, which offers generative AI tools to law firms for IP and patent law work, raised a $40M Series B, bringing its total funding to $55M (Mike Butcher/Pathfounders)
- Bundesliga Soccer Livestream: How to Watch Bayern Munich vs. Mainz
- Nvidia’s H200 AI Chip Gets a Potential Second Act in China - Bloomberg.com
- As world leaders debate AI governance, three billion people can’t even get online - Reuters
- Want job security in the age of AI? Get a state license – any state license
- New York Snow to End by Midday Before Temperatures Plummet Again - Bloomberg.com
- As gerrymandering battles sweep country, supporters say partisan dominance is ‘fair’ - AP News
- Bystander who tackled armed man at Bondi Beach shooting hailed as hero - Reuters
- Why celebrities are loving crypto again in Trump’s second term
- Australia Flags $13.3 Billion Savings as Budget Strains Grow - Bloomberg.com
- How media coverage of Trump's AI EO overstated federal authority over states and overlooked how the order's interstate commerce argument could backfire (Mike Masnick/Techdirt)
- Experts urge caution as Trump’s big bill incentivizes AI in healthcare
- Lukas Nelson on competing for a Grammy against his famous dad - Los Angeles Times
- China Vanke bondholders reject payment extension, raising default risk - Reuters
- US startup seeks to reclaim Twitter trademarks 'abandoned' by Musk’s X - Reuters
- Caitlin Clark on CBA negotiations: ‘Biggest moment in the history of the WNBA’ - Los Angeles Times
- Kremlin says NATO's Rutte is irresponsible to talk of war with Russia - Reuters
- Ukraine's Zelenskiy ditches NATO ambition ahead of peace talks - Reuters
- Thailand says Cambodian rocket fire has caused its first civilian death in new border fighting - AP News
- A profile of ASML, Europe's most valuable company, as it prepares for a transition to High NA EUV, with high-volume manufacturing expected in 2027 and 2028 (Bloomberg)
- Federal judge issues order to prohibit immigration officials from detaining Kilmar Abrego Garcia - Los Angeles Times
- Photos show Arctic air blast hitting northern US and waterlogged Pacific Northwest - AP News
- Sustainable Switch Climate Focus: Do rising temperatures cause Asia’s deadly storms? - Reuters
- A University of Cambridge analysis reveals how cheap SMS text message verification to create online accounts fuels global influence and manipulation campaigns (Clive Cookson/Financial Times)
- The AI boom is delaying US municipal projects, as ~$4T in AI infra spending through 2030 shifts skilled construction workers to AI data centers (Brooke Sutherland/Bloomberg)
- Why Humanoid Robots and Embodied AI Still Struggle in the Real World : General-purpose robots remain rare not for a lack of hardware but because we still can’t give machines the physical intuition humans learn throu...
- Esusu, which offers a rent reporting API to Zillow, banks, and others to help renters build credit scores, raised a $50M Series C at a $1.2B valuation (Krysta Escobar/CNBC)
- Prime Security, which develops AI agents that help with security design during software development, raised a $20M Series A led by Scale Venture Partners (Chris Metinko/Axios)
- SuperCircle, which offers an AI-powered reverse logistics and recycling management service for retail brands, raised a $24M+ Series A led by Foundry Group (Duncan Riley/SiliconANGLE)
- Qargo, which offers a cloud-based transport management service for carriers, freight forwarders, and third-party logistics, raised a $33M Series B led by Sofina (Tamara Djurickovic/Tech.eu)
- Outset, which develops AI agents that help Microsoft and other companies conduct customer research and surveys, raised a $30M Series B led by Radical Ventures (Chris Metinko/Axios)
- Sources: OpenAI told staff it was ending the six-month "vesting cliff" that required new employees to work for at least six months before their equity vests (Wall Street Journal)
- The US CFTC withdraws its 2020 guidance on the "actual delivery" of a digital asset, aiming to support broader access to regulated crypto markets (Micah Zimmerman/Bitcoin Magazine)
- Q&A with Microsoft AI CEO Mustafa Suleyman on defining superintelligence, its application in the medical field, universal basic income, regulation, and more (Mishal Husain/Bloomberg)
- Despite talk of an existential US-China AI race, the Chinese state and its major companies are spending more to dominate other domains, such as EVs and robotics (Tim Wu/Financial Times)
- To build more powerful AI systems, some AI leaders are focusing on pursuing an approach called continual learning, which mimics how people learn over time (Shirin Ghaffary/Bloomberg)
- Machine learning just helped researchers create the biggest 3D map of buildings around the world
- Google Has Taken Down AI-Generated Content Following Disney’s Cease and Desist
- A Florida school went into lockdown after AI flagged a clarinet as a gun
- AI data center boom could be bad news for other infrastructure projects
- Inside Rivian’s big bet on AI-powered self-driving
- Notorious 'winter vomiting bug' rising in California. A new norovirus strain could make it worse - Los Angeles Times
- Justin Herbert optimistic about hand injury heading into Chargers-Chiefs showdown - Los Angeles Times
- L.A. City Councilman John Lee violated gift laws on lavish Vegas jaunt, judge says - Los Angeles Times
- Letters to the Editor: Trump wouldn’t have to bail out farmers if he hadn't implemented tariffs in the first place - Los Angeles Times
- China Warns Against Japanese Militarism at Massacre Memorial - Bloomberg.com
- United Flight to Tokyo Returns to Dulles After Engine Fails - Bloomberg.com
- Hold hold JPMorgan Arranges Galaxy Bond Issuance on Solana Blockchain - Bloomberg.com
- Hong Kong, India Fuel Blockbuster Year for Asia Fundraising - Bloomberg.com
- AI Needs Fewer Prophets and More Predictions - Bloomberg.com
- UK police won’t probe claim former prince asked bodyguard to investigate Virginia Giuffre - AP News
- Eritrea withdraws from regional bloc as UN expresses concern over tensions with Ethiopia - AP News
- Peter Greene, a character actor known for role as the villain Zed in ‘Pulp Fiction,’ has died - AP News
- Ukraine says Russian drone attack hit civilian Turkish vessel - Reuters
- Judge says Comey evidence was wrongfully retained, creating hurdle for new charges - Reuters
- Engine failure forces United Airlines flight to return to DC-area airport - Reuters
- With Fed independence in crosshairs, will Supreme Court back Trump again? - Reuters
- Thailand declares curfew along coast as Cambodia border fighting spreads - Reuters
- Breakingviews - Small AI deflation causes high-pitch Oracle squeak - Reuters
- Gavin Newsom pushes back on Trump AI executive order preempting state laws
- For the First Time, AI Analyzes Language as Well as a Human Expert
Total Sources: 374 | Generated: 12/15/2025