AI NEWS
- 13-Year-Old Arrested for Asking ChatGPT How to Kill His Friend
- Sam Altman Warns That AI Industry Is Due for a Spectacular Implosion
- New Yale Study Finds AI Has Had Essentially Zero Impact on Jobs
- Amazing New Tech Turns Your Screen 3D by Tracking Your Eye Position With Your Webcam
- College Student Died Locked Inside a Cybertruck on Fire, Family Now Suing Tesla
- The EU plans a new AI strategy to cut its reliance on US and Chinese technology
- Lazy Parents Are Giving Their Toddlers ChatGPT on Voice Mode to Keep Them Entertained for Hours
- OpenAI's new AI device reportedly faces technical hurdles that could delay its launch
- SAP's vision for the AI era
- OpenAI’s Sora 2 Is Generating Video of SpongeBob Cooking Meth, Highlighting Copyright Concerns
- Reasoning models like Claude Sonnet 4.5 are getting better at spotting security flaws
- Meta's Yann LeCun reportedly clashed with the company over new publication rules
- OpenAI's Sora 2 answers science questions directly in its generated videos
- Meta will start using chatbot conversations to target ads across all major platforms
- Beyond Bengaluru: Karnataka’s Data Centre Push Towards Tier-2 Hubs
AI RESEARCH
- Asteroid: How I built a Comet Browser Clone using Streamlit and TavilySearch — Part 1
- Perplexity’s Comet Browser: The AI-Powered Browser That Just Went Free
- Advanced RAG: Comparing GraphRAG, Corrective RAG, and Self-RAG
- CTO’s ADAPT System: My Five Bets for the Agentic Engineering Era
- The $200 AI Browser That Freaked Out Google Is Now Free — Here’s Why It Matters
- Unpacking the Implications of the US Government’s LLaMA Approval: Your Future in an AI-Driven…
- Understanding the 4 Main Approaches to LLM Evaluation (From Scratch)
- The Sequence Radar #731: Rails, Windows, and Shots — Tinker, DeepSeek V3.2, Sora 2, and Periodic’s $300M
- Building the Practical Foundation of Fine-Tuning Large Language Models (LLMs)
- 6 Next-Gen Python Libraries Redefining Coding in 2025
- The Two Faces of Forecasting
- Why the Trillion-Dollar AI Bubble Could Ruin Your Future
- Quantum Computing + AI; What Happens?
- Multimodal AI: The New Era of AI that Understands Text, Images, Audio, and More
- Scaling Python Applications with Asyncio and Concurrency
- Don’t Panic, Why AI Can’t Replace You
- Unifying Indian Mobile & Internet Plans with AI and Graph Databases — (Production-ready, Gemini…
- How I Automated My Finances with AI and Python
- What is RAG? A Clear and Simple Explanation.
- Algorithm Showdown: Logistic Regression vs. Random Forest vs. XGBoost on Imbalanced Data
CLOUD BUSINESS
- At $24, I recommend this Roku Stick Plus 4K above all others
- The Amazon Fire HD 8 Kids Pro tablet is now $75 off
- Save 32% on this Kindle Scribe bundle before Prime Day
- SysLinuxOS: The Go-To Linux for System Administrators
- Best early Amazon Prime Day deals 2025: Our 75+ favorite sales this October
- A Cloud Built for Python Data Scientists, Not Infrastructure Engineers
- My new favorite Garmin watch of all time got a big satellite upgrade that's changed how I hike
- The best NAS devices of 2025: Expert tested
- Do voice translation earbuds actually work in public? I tested some, here's my verdict
CLOUD SECURITY
CLOUD TECHNICAL
- How to Deploy n8n with Defang
- IGN: Lootbane - Official Announce Trailer
- The Secret to Secure Cloud Access from Restricted Regions: Reverse Proxy Everything
- How to Serve Multiple Themes in Rails Using Sass and esbuild
- Building a Multi-Agent Candidate Search System with Azure AI Foundry
- Orchestro: Trello for Claude Code — with a built-in Scrum Master
- Lambda function scaling vs aws batch
- 90% of Claude Apps Leak Context. Here's How to Fix It Before It Costs You Thousands
- Understanding Deep Learning: The Basics of Neural Networks
- Forgotten Email Accounts: The Hidden Security Trap Developers Overlook
- Microsoft’s “Agent Mode” in Office: The Start of Vibe Working
- 🟢 ACID Properties in Databases: Explained with Real SQL Examples
- Introducing the AWS EKS best practices Mindmap
- Wtf is Docker🐳?
- Beyond the Proxy: Building a Secure, Observable Serverless API with Amazon API Gateway
- DevOps by Doing: Deploying NGINX on Azure Kubernetes Service (AKS) with Terraform
- IGN: Stitch Head - Official Teaser Trailer (2025)
- Lecciones aprendidas de la certificación AWS Security Specialty 🥇
- The 3 Commands That Turn Chaos into Clarity in DevOps
- Getting Started with Python for AI and Machine Learning
- Understanding Linux Kernel Namespaces: The Magic Behind Containers
- Setting Up a GitLab CI/CD Pipeline with DigitalOcean Kubernetes
- How I Made My Server Public Without a Static IP (Thanks, Tailscale!)
- SplitWire-Turkey Kurulumu ve Discord İçin DPI Aşımı Yöntemleri
- IGN: Megabonk - Official Launch Trailer
- 🪨 Realistic Rocks & Cliffs Pack – Natural Terrain Assets for Roblox
- AI in Regulated Industries: Challenges and Opportunities
- The Silent Co-Pilot: How AI is redefining the Network and the Network Engineer
- 🎪 The Great DevOps Circus: How I Deployed a Full-Stack App Without Losing My Mind (A Beginner's Survival Guide).
- Artificial Intelligence in Music Composition: Unlocking Human Creativity
- My first Blog post on Dev.to and more will come, I will post about ML Learning Series, if you are beginner what topics in Mathematics you should cover and what topics you should cover to crack ML jobs.
- Quick tip 2 - Completely ignore node_modules for Docker in Monorepo
- From LLMs to Liability: How Agents Grow Up
- Docker - Basics
- We built an AI agent that turns one product photo into a full marketplace listing
- 💡 Ideias de SaaS Baseadas nas Tendências: bragantino x grêmio, corinthians - mirassol, ufc
- 5 Must-Read OOP, UML, and Design Patterns Books for Software Engineers
- Ovi: An Open Source Alternative To Veo 3 & Sora 2 that can generate AI Videos with Audio
- Exploring the Mysteries of the Universe with AI and Astro Quantum
- Want Some tips to pass your AWS Solutions Architect Exam read this Blog
- IGN: Lootbane - Official Announce Trailer
- I think you should let AI write your code
- Deep Dive into AWS Cloud WAN Core Network Policy: Configuration, Examples, and Strategy
- How to Send Emails in Node.js with Nodemailer: A 2025 Guide
- How to Convert AWS Clicks into CDK/CloudFormation (The EASY Way)
- Call Them Customers: A Mindset Shift for Engineers in the AI Coding Era
- 🧠Why OrKa-Reasoning: what orcas can teach us about building smart agent teams 🐋
- Equillar: Open-Source Fintech Foundation for Blockchain Investment Platforms
- Serverless CI/CD: How I Replaced Jenkins with AWS Lambda and Cut Costs by 93%
- Daily Tech Byte: 2025-10-05
- Building My Smart 2nd Brain, Part 3: API and UI Explained
- MCP vs API: What's the Difference? Will MCP Replace APIs in AI-Driven Systems?
- From the Ghetto to Web3: How I Taught Myself to Build Smart Contracts and AI powered Saas
- Beyond the Prompt: A Developer's Playbook for Ethically Scaling B2B Content with GenAI
- 🐈💀 When My AIs Died: The Rise and Fall of Lynqbit & BarnOwl
- How AI slop impacted content creators
- In the Crosshairs: A Deep Dive into the MGM Resorts Cyber Attack - A Masterclass in Social Engineering
- I Spent 6 Hours Per Blog Post Until I Built This AI Content Platform
- 🎨 Django Templates & Static Files – Building Dynamic HTML
- Mastering Answer Engine Optimization (AEO): A Developer's Toolkit for the AI Search Era
- IGN: Lootbane - Official Announce Trailer
- IGN: Stitch Head - Official Teaser Trailer (2025)
- IGN: SHELL - Official Trailer (2025) Elisabeth Moss, Kate Hudson
- Predicting Survival on the Titanic: A Machine Learning Approach
- 🌐 Django Views – Function-Based Views (FBVs) Explained (Article 4)
- Structured output comparison across popular LLM providers - OpenAI, Gemini, Anthropic, Mistral and AWS Bedrock
- The Django-CFG Manifesto — or, How I Stopped Worshiping settings.py and Let AI Build My Apps
- Losing my bitcoins worth $83,400 felt like the end of the road. I had trusted the wrong people, and in a matter of moments, my hard-earned digital assets were gone. The emptiness and frustration were overwhelming. I thought I would never see my coins agai
- Review and Secure a Lambda Function with an IAM Least Privilege Based Security Policy: CloudTrail and Athena Approach
- AWS Step Functions
- Understanding the Laravel Lifecycle (Explained for Beginners)
- 94% of AI Developers Ignore This Theorem Prover. Here's Why That's Costing Millions.
- Help Needed – Email Sending Issues After Deployment (Node.js/Express)
- AI isn’t about replacing people, it’s about removing the repetitive work that slows them down. When your systems handle routine tasks automatically, your team finally has time to focus on what actually grows the business.
- Want to Understand Bitcoin, Blockchain & Web3? Read This Once and Get It!
- Building an Intelligent RAG Agent with Azure AI Foundry: A Deep Dive into Sreeni-RAG
- The State of Security Protocols in Agent 2 Agent(A2A) Systems.
- Why You Should Use AWS Backup Instead of Custom Lambda Solutions
- Automating AWS Cost Monitoring with Terraform, Lambda, and Slack
- Agents go brrrrrrr
- Custom AI Solutions vs Off-the-Shelf AI: Which Is Right for You?
- #DAY 11: High Availability – Deploying a Reverse Proxy (Nginx)
- Choosing the Right AI Model for Stock Prediction
FINANCIAL
- Greta Thunberg Among Gaza Flotilla Detainees To Leave Israel
- Newcastle Inflict More Pain On Postecoglou, Everton End Palace's Unbeaten Run
- Top iPhone assembler Foxconn posts record revenue for Q3, but falls short of expectations
- Opec+ Plus To Raise Oil Production By 137,000 Barrels A Day In November
- Google's remedy trial continues as it could reshape future of digital advertising
- Russian Strikes Kill Five In Ukraine, Cause Power Outages
GENERAL US
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- 4 Best Artificial Intelligence (AI) Stocks to Buy in October - Yahoo Finance
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Should we worry AI will create deadly bioweapons? Not yet, but one day - New Scientist
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- The origins of hallucinations are traced in specialized brain cells - The Washington Post
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- CoreWeave Inks $14.2 Billion Deal With Meta for AI Cloud Infrastructure - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Cisco Introduces Agentic Capabilities for Next-Generation Collaboration - Cisco Newsroom
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- AI's getting better at faking crowds. Here's why that's cause for concern - npr.org
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Global AI Summit: The AI Economy - The Washington Post
- Essay | AI Doom? No Problem. - The Wall Street Journal
- AI in the military: Testing a new kind of air force - CBS News
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Turns Out, AI Makes Stuff Up to Try to Make Us Happy - CNET
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- AI Compliance: Regulatory Standards and Frameworks - wiz.io
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- 50 NEW Artificial Intelligence Statistics (July 2025) - Exploding Topics
- Essay | AI Doom? No Problem. - The Wall Street Journal
- AI Delphi-2M Predicts 1000+ Disease Risks — Benefits & Risk - Medscape
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Exorcising AI Myths: What's Really Haunting Your Business - Part 1 - Ward and Smith, P.A.
- Video AI-generated actress causing uproar in Hollywood - ABC News - Breaking News, Latest News and Videos
- Microsoft unveils framework for building agentic AI apps - InfoWorld
- Adobe Is in Serious Trouble Because of AI, Morgan Stanley Warns - Futurism
- In the global AI boom, Russia is conspicuously absent - Financial Times
- Cramer: Walmart CEO's AI warning is 'existential,' everyone needs to pay attention - CNBC
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Rising Global Regulation for Artificial Intelligence - Jones Day
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Essay | AI Doom? No Problem. - The Wall Street Journal
- This school district asked students to draft its AI policy - The Washington Post
- This school district asked students to draft its AI policy
- AI Applications Engineer - classifiedsmarketplace.washingtonpost.com
- Analysis | Trump’s ‘Artificial Intelligence Action Plan’ is already stirring debate - The Washington Post
- 10 Top Companies Using AI - The Motley Fool
- Will a Stock Market Crash Follow the AI Boom? Billionaire Ken Griffin Warns About Echoes of the Dot-Com Bubble. - The Motley Fool
- EU pushes new AI strategy to reduce tech reliance on US and China - Financial Times
- OpenAI’s Hunger for Computing Power Has Sam Altman Dashing Around the Globe - The Wall Street Journal
- Europe’s AI Startups Look Stateside for Bigger Checks, Quicker Deals - The Wall Street Journal
- AI chip firm Cerebras files to withdraw highly anticipated US listing - Yahoo Finance
- Nvidia And These AI Plays Lead 5 Stocks Near Buy Points - Investor's Business Daily
- Advocates raise alarm over Pfas pollution from datacenters amid AI boom - The Guardian
- Missouri Delta partners with AI imaging service to enhance mammograms - KFVS12
- How communications teams are measuring AI output - Axios
- Just 4% of organizations are seeing true ROI from AI, finds Atlassian - unleash.ai
- AI Stocks: Bubble or Boom Ahead? - Yahoo Finance
- Why Real Video AI Is Ad Tech’s Next Frontier - AdExchanger
- Vaccines and motherhood: are AI generated health messages working in Kenya and Nigeria? - The Conversation
- The AI Money Vortex - The Atlantic
- Princeton’s Clever AI Just Solved One of Fusion Power’s Biggest Problems - SciTechDaily
- Tilly Norwood: Hollywood is fuming over a new ‘AI actress’ - CNN
- ChatGPT psychosis: AI chatbots are leading some to mental health crises - The Week
- Joint Commission and Coalition for Health AI Issue Guidance on Provider Use of AI - Duane Morris LLP
- The Bull Case For Broadcom (AVGO) Could Change Following Landmark AI Chip Deal and Surging AI Revenues - Yahoo Finance
- OpenAI acquires an AI-powered personal investing app - Engadget
- SoundHound AI Named a Leader in IDC MarketScape for Worldwide General-Purpose Conversational AI Platforms 2025 - Yahoo Finance
- Monday Night Football NFL player props: Self-learning AI likes Jake Browning Over 219.5 passing yards - CBS Sports
- AI lets Russian war widows see their soldier husbands one more time - The Washington Post
- AI lets Russian war widows see their soldier husbands one more time
- Essay | AI Doom? No Problem. - The Wall Street Journal
- Think AI is a bubble? Here’s how to position your stock portfolio. - MarketWatch
- Essay | AI Doom? No Problem. - The Wall Street Journal
- The Case Against Generative AI - wheresyoured.at
- Text With Jesus app draws thousands as creator says AI can help people explore scripture - Fox Business
- Q&A: How is AI enhancing scams? This UVA expert knows - UVA Today
MAINSTREAM
- Scorability, a college sports recruiting marketplace for athletes and coaches, raised $40M led by Bluestone Equity Partners, bringing its total funding to $51M (Jessica Golden/CNBC)
- Using AI as a Therapist? Why Professionals Say You Should Think Again
- Polars, the Amsterdam-based startup behind the popular open-source library for data manipulation of the same name, raised a €18M Series A led by Accel (Anna Heim/TechCrunch)
- ‘Welcome to Derry’ Will Make You Wait for Full Pennywise
- Five killed, energy infrastructure damaged in Russian air attack on Ukraine - Reuters
- Using helicopters and chemical agents, immigration agents become increasingly aggressive in Chicago - AP News
- EU in stalemate over Russia-linked Raiffeisen compensation, diplomats say - Reuters
- Heavy rains kill at least 47 in Nepal, block roads - Reuters
- Russia Targets Much of Ukraine With Missile and Drone Barrage - Bloomberg.com
- Adobe Firefly Creates Videos from Your Images, Discover the AI Tool That Turns Imagination Into Motion
- Apple AirPods 4 are $90 before Prime Day
- Alvys, an AI-powered logistics software provider, raised a $40M Series B led by RTP Global, bringing its total funding to $77M; Alvys has 1000+ customers (Mary Ann Azevedo/Crunchbase News)
- AP reader question: Do federal workers get paid during the government shutdown - AP News
- Ex-NFL quarterback Mark Sanchez stabbed multiple times in altercation leading to charges against him - AP News
- Israel deports 29 more Gaza aid flotilla activists - Reuters
- Musk’s Neuralink Submits Brain Implant Patient Data to Journal - Bloomberg.com
- Suspect arrested after threats against TikTok’s Culver City headquarters
- How to Get an Invite Code for OpenAI's Sora Video Generator App
- Best Air Purifiers for Pets, Large Rooms and Dust, as Tested by Our Experts
- OpenAI's first device with Jony Ive could be delayed due to 'technical issues'
- Insiders detail negotiations between politicians, tech and AI companies, VCs, and others over California's SB 53, the first-in-the-nation AI safety law (Chase DiFeliciantonio/Politico)
- California’s new AI safety law shows regulation and innovation don’t have to clash
- German Army to Tap Anti-Drone Startup Tytan for Air Defense: FAS - Bloomberg.com
- Foxconn reports Q3 revenue of ~$67.71B, up 11% YoY, driven by strong demand for AI products; the company's consumer electronics division posted a slight decline (Ben Blanchard/Reuters)
- Government shutdown enters fifth day as Democrats and Republicans remain at an impasse - AP News
- OpenAI and Jony Ive may be struggling to figure out their AI device
- The FBI estimates that North Koreans posing as IT workers, using stolen IDs and AI-fabricated work, funneled up to $1B into the country over the past five years (Amanda Gerut/Fortune)
- From composting to solar panels, NFL stadiums are working to be more sustainable - AP News
- Another look at Apple's executive succession, as it increases the spotlight on hardware chief John Ternus; sources: Apple weighed hiring a senior Meta AI exec (Mark Gurman/Bloomberg)
- Napheesa Collier cancels meeting with WNBA Commissioner Engelbert amid tensions, AP source says - AP News
- Lenovo Legion Go 2 Review: A Handheld Made For Big, Meaty Claws
- The Reinforcement Gap — or why some AI skills improve faster than others
- The best Amazon Prime Day kitchen deals: Get up to 50 percent off our favorite air fryers and more
- Exclusive: Citing Cuban fighters in Ukraine, US urges allies to shun Havana at UN - Reuters
- Bid to end shutdown fails in Senate; Trump freezes aid to Chicago - Reuters
- Inside Netflix's Newest 'Monster': The True Story of Ed Gein, Explained
- Apple's AirPods 4 drop to $90 for Prime Day
- Prime Day Apple deals include 25 percent off a four-pack of AirTags
- Roamless eSIM Starts Cheap at $1.25/GB, and Our Exclusive 20% Off Code Pushes It Practically Free
- The AI boom is driving memory and storage shortages that may last a decade; OpenAI's Stargate has deals for 900K DRAM wafers per month, or ~40% of global output (Luke James/Tom's Hardware)
- Trump plans aid package for US soybean farmers while seeking trade deal with China - AP News
- Balloons carrying smuggled cigarettes over Lithuania closed Vilnius Airport for hours - AP News
- Gaza flotilla activists allege abuse and humiliation while being detained in Israel - AP News
- New Generation of 2K-Resolution Nest Cameras Released Plus Gemini AI for Smart Homes
- At least 5 dead in large-scale nighttime Russian strike on Ukraine - AP News
- What Past Education Tech Failures Can Teach Us About the Future of AI in Schools
- PitchBook: VC investment in Asia slowed to $48.9B in the first nine months of 2025, just over half of 2024's total, amid uncertainty due to US tariff policies (Pak Yiu/Nikkei Asia)
- How Trump’s War on ‘Woke’ Threatens Pittsburgh's Economic Revival: CityLab Daily - Bloomberg.com
- Britain’s flawed support for Jaguar Land Rover
- A study found that by late 2024, around 24% of English-language corporate press releases and 14% of UN press releases involved LLM-assisted writing (AJ Dellinger/Gizmodo)
- Sources: Sam Altman is on a global tour since September, including UAE and East Asia, seeking funding and urging companies like TSMC to prioritize OpenAI orders (Wall Street Journal)
- Exclusive: IMF not due to vote at Friday meeting on waiver to allow Senegal more cash - Reuters
- Alibaba says its mapping app Amap's destination ranking feature hit 400M users since its launch in September; Amap had a record 360M daily users on October 1 (Xinmei Shen/South China Morning Post)
- Russian strike hits train station in Ukraine, killing one and injuring 30 - Reuters
- A draft proposal outlines the European Commission's "Apply AI strategy", which is set to be presented on October 7 and aims to "strengthen EU AI sovereignty" (Financial Times)
- Sources: OpenAI and Jony Ive have yet to solve key technical and software issues that could delay the company's palm-sized device, slated for release in 2026 (Financial Times)
- EU pushes new AI strategy to reduce tech reliance on US and China
- OpenAI and Jony Ive grapple with technical issues on secretive AI device
- Takaichi Win to Support Japanese Stocks, Weigh on Yen, Bonds - Bloomberg.com
SECURITY
Total Sources: 367 | Generated: 10/5/2025
